DEC1 (NM_017418) Human Tagged ORF Clone

CAT#: RC213429

DEC1 (Myc-DDK-tagged)-Human deleted in esophageal cancer 1 (DEC1)

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: DEC1
• Synonyms: CTS9
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC213429 representing NM_017418
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGACAATGAATGTTCTGGAGGCTGGGAAGTGGAAGAGCATTGTGCCAGCACCTGGTGAGGGCCTTCTTG
  CCGTGTTACACATGATGGTTTTTACTGATGCCCTGCACAGAGAGAGGTCTGTAAAGTGGCAAGCAGGAGT
  CTGCTACAATGGAGGAAAGGATTTTGCTGTATCTCTTGCCAGGCCCAAGGCTGCAGAGGGAATTGCAGAT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC213429 representing NM_017418
  Red=Cloning site Green=Tags(s)
  
  MTMNVLEAGKWKSIVPAPGEGLLAVLHMMVFTDALHRERSVKWQAGVCYNGGKDFAVSLARPKAAEGIAD
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_017418
• ORF Size: 210 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_017418.1, NM_017418.2, NP_059114.1
• RefSeq Size: 1254
• RefSeq ORF: 213
• Locus ID: 50514
• MW: 7.4 kDa
• Gene Summary: The function of this gene is not known. This gene is located in a region commonly deleted in esophageal squamous cell carcinomas. Gene expression is reduced or absent in these carcinomas and thus this is a candidate tumor suppressor gene for esophageal squamous cell carcinomas. [provided by RefSeq, Jul 2008]