p15 INK4b (CDKN2B) (NM_004936) Human Tagged ORF Clone

CAT#: RG204895

  • TrueORF®

CDKN2B (GFP-tagged) - Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1


  "NM_004936" in other vectors (6)

Reconstitution Protocol

USD 460.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "CDKN2B"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol CDKN2B
Synonyms CDK4I; INK4B; MTS2; P15; p15INK4b; TP15
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG204895 representing NM_004936
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGCGAGGAGAACAAGGGCATGCCCAGTGGGGGCGGCAGCGATGAGGGTCTGGCCAGCGCCGCGGCGC
GGGGACTAGTGGAGAAGGTGCGACAGCTCCTGGAAGCCGGCGCGGATCCCAACGGAGTCAACCGTTTCGG
GAGGCGCGCGATCCAGGTCATGATGATGGGCAGCGCCCGCGTGGCGGAGCTGCTGCTGCTCCACGGCGCG
GAGCCCAACTGCGCAGACCCTGCCACTCTCACCCGACCGGTGCATGATGCTGCCCGGGAGGGCTTCCTGG
ACACGCTGGTGGTGCTGCACCGGGCCGGGGCGCGGCTGGACGTGCGCGATGCCTGGGGTCGTCTGCCCGT
GGACTTGGCCGAGGAGCGGGGCCACCGCGACGTTGCAGGGTACCTGCGCACAGCCACGGGGGAC


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG204895 representing NM_004936
Red=Cloning site Green=Tags(s)

MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGA
EPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004936
ORF Size 414 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004936.3, NP_004927.2
RefSeq Size 3878 bp
RefSeq ORF 417 bp
Locus ID 1030
Cytogenetics 9p21.3
Domains ANK
Protein Families Druggable Genome
Protein Pathways Cell cycle, Pathways in cancer, Small cell lung cancer, TGF-beta signaling pathway
Gene Summary 'This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq, Jul 2008]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.