Tmsb4x (NM_031136) Rat Tagged ORF Clone

CAT#: RR208281

Tmsb4x (Myc-DDK-tagged ORF) - Rat thymosin beta 4, X-linked (Tmsb4x), (10 ug)

Specifications

Product Data

• Type: Rat Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Tmsb4x
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RR208281 representing NM_031136
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCTGACAAACCCGATATGGCTGAGATCGAGAAATTCGATAAGTCGAAGTTGAAGAAGACAGAAACAC
  AAGAGAAAAATCCTCTGCCTTCAAAAGAAACAATTGAACAAGAGAAGCAAGCTGGCGAATCG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RR208281 representing NM_031136
  Red=Cloning site Green=Tags(s)
  
  MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_031136
• ORF Size: 132 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_031136.1, NP_112398.1
• RefSeq Size: 686
• RefSeq ORF: 135
• Locus ID: 81814
• MW: 5.1 kDa
• Gene Summary: may play a role in the regulation of actin dynamics; may be involved in osteoblast differentiation and immune response [RGD, Feb 2006]