nonstructural protein NS4B (NC_012532) Virus Tagged ORF Clone
CAT#: VC102537
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS4B [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227204.1
View other clones from "Virus" (13)
Product Images
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | nonstructural protein NS4B |
Synonyms | ZIKV_gp1, ZIKV |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC102537 represents NCBI reference of YP_009227204 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAATGAACTTGGTTGGCTGGAACGAACAAAAAACGATATTGCTCACCTGATGGGACGACGAGAAGAGG GTGCTACGATGGGATTTTCTATGGATATTGACCTCCGACCTGCCAGCGCCTGGGCAATCTATGCTGCCTT GACTACTCTGATTACTCCCGCAGTGCAACACGCAGTTACCACATCTTACAATAACTATTCTCTCATGGCC ATGGCCACACAGGCTGGGGTGCTGTTCGGTATGGGTAAAGGAATGCCATTTATGCACGGCGATCTCGGTG TACCCCTCTTGATGATGGGCTGCTATTCTCAACTGACCCCTCTGACCCTGATCGTAGCTATTATACTGCT GGTCGCACATTATATGTACCTCATCCCAGGTCTTCAGGCAGCGGCAGCGCGGGCAGCACAGAAGAGGACC GCTGCCGGAATCATGAAGAACCCAGTAGTGGATGGAATCGTCGTCACAGACATAGACACCATGACTATTG ATCCTCAGGTGGAAAAGAAAATGGGACAGGTCTTGCTCATTGCAGTTGCTATTTCTTCAGCCGTCTTGCT TAGAACAGCTTGGGGGTGGGGAGAGGCCGGAGCTTTGATCACAGCCGCCACTTCAACACTCTGGGAAGGC TCACCTAACAAATATTGGAACTCATCTACAGCGACGTCTCTTTGTAACATTTTCAGAGGGTCTTATCTCG CGGGCGCATCACTCATATACACTGTCACAAGGAATGCGGGCCTGGTAAAGCGGCGA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC102537 representing YP_009227204
Red=Cloning sites Green=Tags MNELGWLERTKNDIAHLMGRREEGATMGFSMDIDLRPASAWAIYAALTTLITPAVQHAVTTSYNNYSLMA MATQAGVLFGMGKGMPFMHGDLGVPLLMMGCYSQLTPLTLIVAIILLVAHYMYLIPGLQAAAARAAQKRT AAGIMKNPVVDGIVVTDIDTMTIDPQVEKKMGQVLLIAVAISSAVLLRTAWGWGEAGALITAATSTLWEG SPNKYWNSSTATSLCNIFRGSYLAGASLIYTVTRNAGLVKRR myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_012532 |
ORF Size | 756 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NC_012532.1, YP_009227204 |
RefSeq ORF | 756 bp |
MW | 27.1 kDa |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC102527 | Myc-DDK-tagged ORF clone of viral ORF for anchored capsid protein C [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227206.1 |
USD 400.00 |
|
VC102528 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein C [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227196.1 |
USD 400.00 |
|
VC102529 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein precursor M [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227197.1 |
USD 400.00 |
|
VC102530 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein E [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227198.1 |
USD 620.00 |
|
VC102531 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS1 [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227199.1 |
USD 430.00 |
|
VC102532 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS2A [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227200.1 |
USD 400.00 |
|
VC102533 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS2B [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227201.1 |
USD 400.00 |
|
VC102534 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS3 [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227202.1 |
USD 760.00 |
|
VC102535 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS4A [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227203.1 |
USD 400.00 |
|
VC102536 | Myc-DDK-tagged ORF clone of viral ORF for Protein 2K [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227209.1 |
USD 400.00 |
|
VC102538 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS5 [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227205.1 |
USD 1,400.00 |
|
VC102539 | Myc-DDK-tagged ORF clone of viral ORF for Membrane glycoprotein M [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227208.1 |
USD 400.00 |
|
VC102540 | Myc-DDK-tagged ORF clone of viral ORF for Protein pr [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227207.1 |
USD 400.00 |
{0} Product Review(s)
Be the first one to submit a review