membrane glycoprotein M (NC_012532) Virus Tagged ORF Clone
CAT#: VC102539
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for Membrane glycoprotein M [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227208.1
View other clones from "Virus" (13)
Product Images
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | membrane glycoprotein M |
Synonyms | ZIKV_gp1, ZIKV |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC102539 represents NCBI reference of YP_009227208 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTGTTACACTCCCGTCCCACTCTACTCGAAAACTTCAGACGCGCTCTCAAACATGGCTCGAATCCC GCGAATACACCAAACATCTCATCAAGGTTGAAAATTGGATCTTCAGAAACCCCGGATTTGCTCTTGTCGC TGTGGCAATTGCTTGGCTCCTCGGCTCCTCCACATCCCAGAAAGTGATCTATCTTGTTATGATCTTGCTC ATCGCCCCCGCATATTCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC102539 representing YP_009227208
Red=Cloning sites Green=Tags MAVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALVAVAIAWLLGSSTSQKVIYLVMILL IAPAYS myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_012532 |
ORF Size | 228 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Reference Data | |
RefSeq | NC_012532.1, YP_009227208 |
RefSeq ORF | 228 |
MW | 8.6 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC102527 | Myc-DDK-tagged ORF clone of viral ORF for anchored capsid protein C [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227206.1 |
USD 400.00 |
|
VC102528 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein C [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227196.1 |
USD 400.00 |
|
VC102529 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein precursor M [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227197.1 |
USD 400.00 |
|
VC102530 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein E [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227198.1 |
USD 620.00 |
|
VC102531 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS1 [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227199.1 |
USD 430.00 |
|
VC102532 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS2A [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227200.1 |
USD 400.00 |
|
VC102533 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS2B [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227201.1 |
USD 400.00 |
|
VC102534 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS3 [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227202.1 |
USD 760.00 |
|
VC102535 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS4A [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227203.1 |
USD 400.00 |
|
VC102536 | Myc-DDK-tagged ORF clone of viral ORF for Protein 2K [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227209.1 |
USD 400.00 |
|
VC102537 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS4B [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227204.1 |
USD 400.00 |
|
VC102538 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS5 [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227205.1 |
USD 1,400.00 |
|
VC102540 | Myc-DDK-tagged ORF clone of viral ORF for Protein pr [Zika virus, strain MR766], codon optimized for human cell expression, YP_009227207.1 |
USD 400.00 |
{0} Product Review(s)
Be the first one to submit a review