CUTA (NM_001014838) Human Mass Spec Standard

CAT#: PH300075

CUTA MS Standard C13 and N15-labeled recombinant protein (NP_001014838)

Product Images

Coomassie blue staining of purified CUTA protein (Cat# TP300075). The protein was produced from HEK293T cells transfected with CUTA cDNA clone (Cat# RC200075) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200075
• Predicted MW: 16.8 kDa
• Protein Sequence:
  Sequence Link

  >RC200075 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRL
  AACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQW
  VRQVTESVSDSITVLP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001014838
• RefSeq Size: 1041
• RefSeq ORF: 468
• Synonyms: ACHAP; C6orf82
• Locus ID: 51596
• UniProt ID: O60888
• Cytogenetics: 6p21.32
• Summary: May form part of a complex of membrane proteins attached to acetylcholinesterase (AChE). [UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane