TMEM14B (NM_030969) Human Mass Spec Standard
CAT#: PH300239
TMEM14B MS Standard C13 and N15-labeled recombinant protein (NP_112231)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200239 |
Predicted MW | 12.2 kDa |
Protein Sequence |
>RC200239 protein sequence
Red=Cloning site Green=Tags(s) MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAWLLFGSLAGLGAYQLYQDPRNVWGFLAAT SVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_112231 |
RefSeq Size | 992 |
RefSeq ORF | 342 |
Synonyms | FLJ60468; MGC1223 |
Locus ID | 81853 |
UniProt ID | Q9NUH8, A0A024QZV7 |
Cytogenetics | 6p24.2 |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410633 | TMEM14B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410633 | Transient overexpression lysate of transmembrane protein 14B (TMEM14B), transcript variant 1 |
USD 396.00 |
|
TP300239 | Recombinant protein of human transmembrane protein 14B (TMEM14B), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review