Chemerin (RARRES2) (NM_002889) Human Mass Spec Standard

CAT#: PH300383

RARRES2 MS Standard C13 and N15-labeled recombinant protein (NP_002880)

Product Images

Coomassie blue staining of purified RARRES2 protein (Cat# TP300383). The protein was produced from HEK293T cells transfected with RARRES2 cDNA clone (Cat# RC200383) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200383
• Predicted MW: 18.6 kDa
• Protein Sequence:
  Sequence Link

  >RC200383 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEF
  KLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQR
  AGEDPHSFYFPGQFAFSKALPRS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002880
• RefSeq Size: 767
• RefSeq ORF: 489
• Synonyms: HP10433; TIG2
• Locus ID: 5919
• UniProt ID: Q99969, A0A090N7U9
• Cytogenetics: 7q36.1
• Summary: 'This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine and as an antimicrobial protein with activity against bacteria and fungi. [provided by RefSeq, Nov 2014]'
• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Secreted Protein