ARL2 (NM_001667) Human Mass Spec Standard

CAT#: PH300501

ARL2 MS Standard C13 and N15-labeled recombinant protein (NP_001658)

Product Images

Coomassie blue staining of purified ARL2 protein (Cat# TP300501). The protein was produced from HEK293T cells transfected with ARL2 cDNA clone (Cat# RC200501) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200501
• Predicted MW: 20.9 kDa
• Protein Sequence:
  Sequence Link

  >RC200501 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQ
  KSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIRE
  VLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001658
• RefSeq Size: 993
• RefSeq ORF: 552
• Synonyms: ARFL2
• Locus ID: 402
• UniProt ID: P36404, Q53YD8
• Cytogenetics: 11q13.1
• Summary: This gene encodes a small GTP-binding protein of the RAS superfamily which functions as an ADP-ribosylation factor (ARF). The encoded protein is one of a functionally distinct group of ARF-like genes. [provided by RefSeq, Jul 2008]