NME6 (NM_005793) Human Mass Spec Standard

CAT#: PH300541

NME6 MS Standard C13 and N15-labeled recombinant protein (NP_005784)

Product Images

Coomassie blue staining of purified NME6 protein (Cat# TP300541). The protein was produced from HEK293T cells transfected with NME6 cDNA clone (Cat# RC200541) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200541
• Predicted MW: 22 kDa
• Protein Sequence:
  Sequence Link

  >RC200541 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTQNLGSEMASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYRE
  HEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSD
  SVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005784
• RefSeq Size: 1189
• RefSeq ORF: 582
• Synonyms: IPIA-ALPHA; NDK 6; NM23-H6
• Locus ID: 10201
• UniProt ID: O75414, A0A0C4DG91
• Cytogenetics: 3p21.31
• Summary: Nucleoside diphosphate (NDP) kinases (EC 2.7.4.6), such as NME6, are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates (Mehus et al., 1999 [PubMed 10453732]). [supplied by OMIM, Jul 2010]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Purine metabolism, Pyrimidine metabolism