LDOC1 (NM_012317) Human Mass Spec Standard

CAT#: PH300543

LDOC1 MS Standard C13 and N15-labeled recombinant protein (NP_036449)

Product Images

Coomassie blue staining of purified LDOC1 protein (Cat# TP300543). The protein was produced from HEK293T cells transfected with LDOC1 cDNA clone (Cat# RC200543) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200543
• Predicted MW: 17 kDa
• Protein Sequence:
  Sequence Link

  >RC200543 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQ
  TASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDE
  EEEDDY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036449
• RefSeq Size: 1470
• RefSeq ORF: 438
• Synonyms: BCUR1; Mar7; Mart7; RTL7; SIRH7
• Locus ID: 23641
• UniProt ID: O95751
• Cytogenetics: Xq27.1
• Summary: The protein encoded by this gene contains a leucine zipper-like motif and a proline-rich region that shares marked similarity with an SH3-binding domain. The protein localizes to the nucleus and is down-regulated in some cancer cell lines. It is thought to regulate the transcriptional response mediated by the nuclear factor kappa B (NF-kappaB). The gene has been proposed as a tumor suppressor gene whose protein product may have an important role in the development and/or progression of some cancers. [provided by RefSeq, Jul 2008]