PRKRA (NM_003690) Human Mass Spec Standard

CAT#: PH300578

PRKRA MS Standard C13 and N15-labeled recombinant protein (NP_003681)

Product Images

Coomassie blue staining of purified PRKRA protein (Cat# TP300578). The protein was produced from HEK293T cells transfected with PRKRA cDNA clone (Cat# RC200578) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200578
• Predicted MW: 34.4 kDa
• Protein Sequence:
  Sequence Link

  >RC200578 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRV
  TVGDITCTGEGTSKKLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGW
  RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENHISLTNVVGHS
  LGCTWHSLRNSPGEKINLLKRSLLSIPNTDYIQLLSEIAKEQGFNITYLDIDELSANGQYQCLAELSTSP
  ITVCHGSGISCGNAQSDAAHNALQYLKIIAERK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003681
• RefSeq Size: 1826
• RefSeq ORF: 939
• Synonyms: DYT16; HSD14; PACT; RAX
• Locus ID: 8575
• UniProt ID: O75569
• Cytogenetics: 2q31.2
• Summary: This gene encodes a protein kinase activated by double-stranded RNA which mediates the effects of interferon in response to viral infection. Mutations in this gene have been associated with dystonia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2008]
• Protein Families: Druggable Genome