TMED9 (NM_017510) Human Mass Spec Standard
CAT#: PH300652
TMED9 MS Standard C13 and N15-labeled recombinant protein (NP_059980)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200652 |
Predicted MW | 27.3 kDa |
Protein Sequence |
>RC200652 protein sequence
Red=Cloning site Green=Tags(s) MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYD KQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVH LDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQ TLILVAIGVWQMRHLKSFFEAKKLV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_059980 |
RefSeq Size | 1402 |
RefSeq ORF | 705 |
Synonyms | GMP25; HSGP25L2G; p24a2; p24alpha2; p25 |
Locus ID | 54732 |
UniProt ID | Q9BVK6, A0A024R7M0 |
Cytogenetics | 5q35.3 |
Summary | This gene is a member of a family of genes encoding transport proteins located in the endoplasmic reticulum and the Golgi. A similar gene in mouse is the target of microRNA miR-296, which is part of an imprinted cluster. [provided by RefSeq, Jul 2016] |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402594 | TMED9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402594 | Transient overexpression lysate of transmembrane emp24 protein transport domain containing 9 (TMED9) |
USD 396.00 |
|
TP300652 | Recombinant protein of human transmembrane emp24 protein transport domain containing 9 (TMED9) |
USD 439.00 |
{0} Product Review(s)
Be the first one to submit a review