TMED9 (NM_017510) Human Mass Spec Standard

CAT#: PH300652

TMED9 MS Standard C13 and N15-labeled recombinant protein (NP_059980)

Product Images

Coomassie blue staining of purified TMED9 protein (Cat# TP300652). The protein was produced from HEK293T cells transfected with TMED9 cDNA clone (Cat# RC200652) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200652
• Predicted MW: 27.3 kDa
• Protein Sequence:
  Sequence Link

  >RC200652 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYD
  KQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVH
  LDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQ
  TLILVAIGVWQMRHLKSFFEAKKLV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_059980
• RefSeq Size: 1402
• RefSeq ORF: 705
• Synonyms: GMP25; HSGP25L2G; p24a2; p24alpha2; p25
• Locus ID: 54732
• UniProt ID: Q9BVK6, A0A024R7M0
• Cytogenetics: 5q35.3
• Summary: This gene is a member of a family of genes encoding transport proteins located in the endoplasmic reticulum and the Golgi. A similar gene in mouse is the target of microRNA miR-296, which is part of an imprinted cluster. [provided by RefSeq, Jul 2016]
• Protein Families: Transmembrane