FKBP12 (FKBP1A) (NM_054014) Human Mass Spec Standard

CAT#: PH300662

FKBP1A MS Standard C13 and N15-labeled recombinant protein (NP_463460)

Product Images

Coomassie blue staining of purified FKBP1A protein (Cat# TP300662). The protein was produced from HEK293T cells transfected with FKBP1A cDNA clone (Cat# RC200662) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200662
• Predicted MW: 12 kDa
• Protein Sequence:
  Sequence Link

  >RC200662 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVG
  QRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_463460
• RefSeq Size: 901
• RefSeq ORF: 324
• Synonyms: FKBP-1A; FKBP-12; FKBP1; FKBP12; PKC12; PKCI2; PPIASE
• Locus ID: 2280
• UniProt ID: P62942
• Cytogenetics: 20p13
• Summary: 'The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed. [provided by RefSeq, Sep 2008]'
• Protein Families: Druggable Genome