CYBC1 (NM_001033046) Human Mass Spec Standard

CAT#: PH300883

C17orf62 MS Standard C13 and N15-labeled recombinant protein (NP_001028218)

Product Images

Coomassie blue staining of purified CYBC1 protein (Cat# TP300883). The protein was produced from HEK293T cells transfected with CYBC1 cDNA clone (Cat# RC200883) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200883
• Predicted MW: 20.8 kDa
• Protein Sequence:
  Sequence Link

  >RC200883 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MYLQVETRTSSRLHLKRAPGIRSWSLLVGILSIGLAAAYYSGDSLGWKLFYVTGCLFVAVQNLEDWEEAI
  FDKSTGKVVLKTFSLYKKLLTLFRAGHDQVVVLLHDVRDVSVEEEKVRYFGKGYMVVLRLATGFSHPLTQ
  SAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001028218
• RefSeq Size: 2167
• RefSeq ORF: 561
• Synonyms: C17orf62; CGD5; Eros
• Locus ID: 79415
• UniProt ID: Q9BQA9, A0A024R8W9
• Cytogenetics: 17q25.3
• Protein Families: Transmembrane