SCNM1 (NM_024041) Human Mass Spec Standard

CAT#: PH300987

SCNM1 MS Standard C13 and N15-labeled recombinant protein (NP_076946)

Product Images

Coomassie blue staining of purified SCNM1 protein (Cat# TP300987). The protein was produced from HEK293T cells transfected with SCNM1 cDNA clone (Cat# RC200987) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200987
• Predicted MW: 25.9 kDa
• Protein Sequence:
  Sequence Link

  >RC200987 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSFKREGDDWSQLNVLKKRRVGDLLASYIPEDEALMLRDGRFACAICPHRPVLDTLAMLTAHRAGKKHLS
  SLQLFYGKKQPGKERKQNPKHQNELRREETKAEAPLLTQTRLITQSALHRAPHYNSCCRRKYRPEAPGPS
  VSLSPMPPSEVKLQSGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYLTLRSSGWIPDGRGRWV
  KDENVEFDSDEEEPPDLPLD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_076946
• RefSeq Size: 2036
• RefSeq ORF: 690
• Synonyms: MGC3180
• Locus ID: 79005
• UniProt ID: Q9BWG6
• Cytogenetics: 1q21.3
• Summary: SCNM1 is a zinc finger protein and putative splicing factor. In mice, Scnm1 modifies phenotypic expression of Scn8a (MIM 600702) mutations (Buchner et al., 2003 [PubMed 12920299]). [supplied by OMIM, Oct 2009]