p19 INK4d (CDKN2D) (NM_079421) Human Mass Spec Standard
CAT#: PH301155
CDKN2D MS Standard C13 and N15-labeled recombinant protein (NP_524145)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201155 |
Predicted MW | 17.7 kDa |
Protein Sequence |
>RC201155 protein sequence
Red=Cloning site Green=Tags(s) MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQ DTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGL TPLELALQRGAQDLVDILQGHMVAPL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_524145 |
RefSeq Size | 1162 |
RefSeq ORF | 498 |
Synonyms | INK4D; p19; p19-INK4D |
Locus ID | 1032 |
UniProt ID | P55273, A0A024R796 |
Cytogenetics | 19p13.2 |
Summary | The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400682 | CDKN2D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC409201 | CDKN2D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400682 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 1 |
USD 396.00 |
|
LY409201 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2 |
USD 396.00 |
|
PH314065 | CDKN2D MS Standard C13 and N15-labeled recombinant protein (NP_001791) |
USD 2,055.00 |
|
TP301155 | Recombinant protein of human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2 |
USD 823.00 |
|
TP314065 | Recombinant protein of human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review