Perilipin 3 (PLIN3) (NM_005817) Human Mass Spec Standard

CAT#: PH301193

PLIN3 MS Standard C13 and N15-labeled recombinant protein (NP_005808)

Product Images

Coomassie blue staining of purified PLIN3 protein (Cat# TP301193). The protein was produced from HEK293T cells transfected with PLIN3 cDNA clone (Cat# RC201193) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201193
• Predicted MW: 46.9 kDa
• Protein Sequence:
  Sequence Link

  >RC201193 representing NM_005817
  Red=Cloning site Green=Tags(s)
  
  MSADGAEADGSTQVTVEEPVQQPSVVDRVASMPLISSTCDMVSAAYASTKESYPHIKTVCDAAEKGVRTL
  TAAAVSGAQPILSKLEPQIASASEYAHRGLDKLEENLPILQQPTEKVLADTKELVSSKVSGAQEMVSSAK
  DTVATQLSEAVDATRGAVQSGVDKTKSVVTGGVQSVMGSRLGQMVLSGVDTVLGKSEEWADNHLPLTDAE
  LARIATSLDGFDVASVQQQRQEQSYFVRLGSLSERLRQHAYEHSLGKLRATKQRAQEALLQLSQALSLME
  TVKQGVDQKLVEGQEKLHQMWLSWNQKQLQGPEKEPPKPEQVESRALTMFRDIAQQLQATCTSLGSSIQG
  LPTNVKDQVQQARRQVEDLQATFSSIHSFQDLSSSILAQSRERVASAREALDHMVEYVAQNTPVTWLVGP
  FAPGITEKAPEEKK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005808
• RefSeq Size: 2241
• RefSeq ORF: 1302
• Synonyms: M6PRBP1; PP17; TIP47
• Locus ID: 10226
• UniProt ID: O60664
• Cytogenetics: 19p13.3
• Summary: Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009]
• Protein Families: Druggable Genome