FKBP12 (FKBP1A) (NM_000801) Human Mass Spec Standard
CAT#: PH301237
FKBP1A MS Standard C13 and N15-labeled recombinant protein (NP_000792)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201237 |
Predicted MW | 12 kDa |
Protein Sequence |
>RC201237 protein sequence
Red=Cloning site Green=Tags(s) MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVG QRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000792 |
RefSeq Size | 1643 |
RefSeq ORF | 324 |
Synonyms | FKBP-1A; FKBP-12; FKBP1; FKBP12; PKC12; PKCI2; PPIASE |
Locus ID | 2280 |
UniProt ID | P62942, Q0VDC6 |
Cytogenetics | 20p13 |
Summary | 'The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed. [provided by RefSeq, Sep 2008]' |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400279 | FKBP1A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC409302 | FKBP1A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400279 | Transient overexpression lysate of FK506 binding protein 1A, 12kDa (FKBP1A), transcript variant 12B |
USD 396.00 |
|
LY409302 | Transient overexpression lysate of FK506 binding protein 1A, 12kDa (FKBP1A), transcript variant 12A |
USD 396.00 |
|
PH300662 | FKBP1A MS Standard C13 and N15-labeled recombinant protein (NP_463460) |
USD 2,055.00 |
|
TP300662 | Recombinant protein of human FK506 binding protein 1A, 12kDa (FKBP1A), transcript variant 12A |
USD 823.00 |
|
TP301237 | Recombinant protein of human FK506 binding protein 1A, 12kDa (FKBP1A), transcript variant 12B |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review