SCGN (NM_006998) Human Mass Spec Standard
CAT#: PH301359
SCGN MS Standard C13 and N15-labeled recombinant protein (NP_008929)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201359 |
Predicted MW | 31.9 kDa |
Protein Sequence |
>RC201359 representing NM_006998
Red=Cloning site Green=Tags(s) MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQ DASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLH HKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYD VSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_008929 |
RefSeq Size | 1492 |
RefSeq ORF | 828 |
Synonyms | CALBL; DJ501N12.8; SECRET; SEGN; setagin |
Locus ID | 10590 |
UniProt ID | O76038 |
Cytogenetics | 6p22.2 |
Summary | The encoded protein is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416264 | SCGN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416264 | Transient overexpression lysate of secretagogin, EF-hand calcium binding protein (SCGN) |
USD 396.00 |
|
TP301359 | Purified recombinant protein of Homo sapiens secretagogin, EF-hand calcium binding protein (SCGN) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review