Apolipoprotein O (APOO) (NM_024122) Human Mass Spec Standard
CAT#: PH301451
APOO MS Standard C13 and N15-labeled recombinant protein (NP_077027)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201451 |
| Predicted MW | 22.3 kDa |
| Protein Sequence |
>RC201451 protein sequence
Red=Cloning site Green=Tags(s) MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHY CEPYTTWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPP GFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_077027 |
| RefSeq Size | 1134 |
| RefSeq ORF | 594 |
| Synonyms | FAM121B; Mic23; MIC26; MICOS26; My025 |
| Locus ID | 79135 |
| UniProt ID | Q9BUR5 |
| Cytogenetics | Xp22.11 |
| Summary | This gene is a member of the apolipoprotein family. Members of this protein family are involved in the transport and metabolism of lipids. The encoded protein associates with HDL, LDL and VLDL lipoproteins and is characterized by chondroitin-sulfate glycosylation. This protein may be involved in preventing lipid accumulation in the myocardium in obese and diabetic patients. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 4, 5, 12 and 16. [provided by RefSeq, Sep 2009] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411353 | APOO HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY411353 | Transient overexpression lysate of apolipoprotein O (APOO), transcript variant 1 |
USD 436.00 |
|
| TP301451 | Recombinant protein of human apolipoprotein O (APOO), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China