ACAD8 (NM_014384) Human Mass Spec Standard

CAT#: PH301507

ACAD8 MS Standard C13 and N15-labeled recombinant protein (NP_055199)

Product Images

Coomassie blue staining of purified ACAD8 protein (Cat# TP301507). The protein was produced from HEK293T cells transfected with ACAD8 cDNA clone (Cat# RC201507) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201507
• Predicted MW: 45.1 kDa
• Protein Sequence:
  Sequence Link

  >RC201507 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQK
  ELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEE
  QRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGL
  GPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINI
  ASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVAL
  CSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055199
• RefSeq Size: 2216
• RefSeq ORF: 1245
• Synonyms: ACAD-8; ARC42
• Locus ID: 27034
• UniProt ID: Q9UKU7
• Cytogenetics: 11q25
• Summary: This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. The encoded protein is a mitochondrial enzyme that functions in catabolism of the branched-chain amino acid valine. Defects in this gene are the cause of isobutyryl-CoA dehydrogenase deficiency. [provided by RefSeq, Nov 2009]
• Protein Families: Transcription Factors
• Protein Pathways: Metabolic pathways, Valine, leucine and isoleucine degradation