Pallidin (BLOC1S6) (NM_012388) Human Mass Spec Standard

CAT#: PH301514

PLDN MS Standard C13 and N15-labeled recombinant protein (NP_036520)

Product Images

Coomassie blue staining of purified BLOC1S6 protein (Cat# TP301514). The protein was produced from HEK293T cells transfected with BLOC1S6 cDNA clone (Cat# RC201514) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201514
• Predicted MW: 19.7 kDa
• Protein Sequence:
  Sequence Link

  >RC201514 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQA
  LQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQ
  QKRQKEELEREQQREKEFEREKQLTARPAKRM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036520
• RefSeq Size: 3959
• RefSeq ORF: 516
• Synonyms: BLOS6; HPS9; PA; PALLID; PLDN
• Locus ID: 26258
• UniProt ID: Q9UL45, B3KY40
• Cytogenetics: 15q21.1
• Summary: The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Mutations in this gene cause symptoms associated with Hermansky-Pudlak syndrome-9. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the X chromosome. [provided by RefSeq, Aug 2015]