RAB1A (NM_004161) Human Mass Spec Standard

CAT#: PH301640

RAB1A MS Standard C13 and N15-labeled recombinant protein (NP_004152)

Product Images

Coomassie blue staining of purified RAB1A protein (Cat# TP301640). The protein was produced from HEK293T cells transfected with RAB1A cDNA clone (Cat# RC201640) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201640
• Predicted MW: 22.7 kDa
• Protein Sequence:
  Sequence Link

  >RC201640 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQ
  ERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAK
  EFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004152
• RefSeq Size: 2648
• RefSeq ORF: 615
• Synonyms: RAB1; YPT1
• Locus ID: 5861
• UniProt ID: P62820, Q5U0I6
• Cytogenetics: 2p14
• Summary: 'This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multiple alternatively spliced transcript variants have been identified for this gene which encode different protein isoforms. [provided by RefSeq, Oct 2008]'
• Protein Families: Druggable Genome