Adrenodoxin (FDX1) (NM_004109) Human Mass Spec Standard

CAT#: PH301647

FDX1 MS Standard C13 and N15-labeled recombinant protein (NP_004100)

Product Images

Coomassie blue staining of purified FDX1 protein (Cat# TP301647). The protein was produced from HEK293T cells transfected with FDX1 cDNA clone (Cat# RC201647) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201647
• Predicted MW: 19.4 kDa
• Protein Sequence:
  Sequence Link

  >RC201647 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVH
  FINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDL
  AYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004100
• RefSeq Size: 3155
• RefSeq ORF: 552
• Synonyms: ADX; FDX; LOH11CR1D
• Locus ID: 2230
• UniProt ID: P10109
• Cytogenetics: 11q22.3
• Summary: 'This gene encodes a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to mitochondrial cytochrome P450, involved in steroid, vitamin D, and bile acid metabolism. Pseudogenes of this functional gene are found on chromosomes 20 and 21. [provided by RefSeq, Aug 2011]'