NBL1 (NM_005380) Human Mass Spec Standard

CAT#: PH301954

NBL1 MS Standard C13 and N15-labeled recombinant protein (NP_005371)

Product Images

Coomassie blue staining of purified NBL1 protein (Cat# TP301954). The protein was produced from HEK293T cells transfected with NBL1 cDNA clone (Cat# RC201954) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201954
• Predicted MW: 19.3 kDa
• Protein Sequence:
  Sequence Link

  >RC201954 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNT
  FPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDG
  PGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005371
• RefSeq Size: 2184
• RefSeq ORF: 540
• Synonyms: D1S1733E; DAN; DAND1; NB; NO3
• Locus ID: 4681
• UniProt ID: P41271
• Cytogenetics: 1p36.13
• Summary: 'This gene product is the founding member of the evolutionarily conserved CAN (Cerberus and DAN) family of proteins, which contain a domain resembling the CTCK (C-terminal cystine knot-like) motif found in a number of signaling molecules. These proteins are secreted, and act as BMP (bone morphogenetic protein) antagonists by binding to BMPs and preventing them from interacting with their receptors. They may thus play an important role during growth and development. Alternatively spliced transcript variants have been identified for this gene. Read-through transcripts between this locus and the upstream mitochondrial inner membrane organizing system 1 gene (GeneID 440574) have been observed. [provided by RefSeq, May 2013]'
• Protein Families: Secreted Protein