EMP2 (NM_001424) Human Mass Spec Standard

CAT#: PH301995

EMP2 MS Standard C13 and N15-labeled recombinant protein (NP_001415)

Product Images

Coomassie blue staining of purified EMP2 protein (Cat# TP301995). The protein was produced from HEK293T cells transfected with EMP2 cDNA clone (Cat# RC201995) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201995
• Predicted MW: 19.2 kDa
• Protein Sequence:
  Sequence Link

  >RC201995 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYSTLQAVQATMIL
  STILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYG
  YSYILAWVAFACTFISGMMYLILRKRK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001415
• RefSeq Size: 5186
• RefSeq ORF: 501
• Synonyms: XMP
• Locus ID: 2013
• UniProt ID: P54851, Q7Z4B3
• Cytogenetics: 16p13.13
• Summary: 'This gene encodes a tetraspan protein of the PMP22/EMP family. The encoded protein regulates cell membrane composition. It has been associated with various functions including endocytosis, cell signaling, cell proliferation, cell migration, cell adhesion, cell death, cholesterol homeostasis, urinary albumin excretion, and embryo implantation. It is known to negatively regulate caveolin-1, a scaffolding protein which is the main component of the caveolae plasma membrane invaginations found in most cell types. Through activation of PTK2 it positively regulates vascular endothelial growth factor A. It also modulates the function of specific integrin isomers in the plasma membrane. Up-regulation of this gene has been linked to cancer progression in multiple different tissues. Mutations in this gene have been associated with nephrotic syndrome type 10 (NPHS10). [provided by RefSeq, Mar 2015]'
• Protein Families: Transmembrane