RBBP9 (NM_006606) Human Mass Spec Standard

CAT#: PH302090

RBBP9 MS Standard C13 and N15-labeled recombinant protein (NP_006597)

Product Images

Coomassie blue staining of purified RBBP9 protein (Cat# TP302090). The protein was produced from HEK293T cells transfected with RBBP9 cDNA clone (Cat# RC202090) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202090
• Predicted MW: 21 kDa
• Protein Sequence:
  Sequence Link

  >RC202090 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITARESIWLPFMETELHCDEKTI
  IIGHSSGAIAAMRYAETHRVYAIVLVSAYTSDLGDENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPF
  LPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKSLLKVPA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006597
• RefSeq Size: 3871
• RefSeq ORF: 558
• Synonyms: BOG; RBBP10
• Locus ID: 10741
• UniProt ID: O75884
• Cytogenetics: 20p11.23
• Summary: The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate. [provided by RefSeq, Jul 2008]