ZMAT5 (NM_019103) Human Mass Spec Standard
CAT#: PH302215
ZMAT5 MS Standard C13 and N15-labeled recombinant protein (NP_061976)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202215 |
Predicted MW | 20 kDa |
Protein Sequence |
>RC202215 protein sequence
Red=Cloning site Green=Tags(s) MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGS NCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYP VGWPPVQELPPSLRAPPPGGWPLQPRVQWG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_061976 |
RefSeq Size | 1051 |
RefSeq ORF | 510 |
Synonyms | SNRNP20; U11/U12-20K; ZC3H19 |
Locus ID | 55954 |
UniProt ID | Q9UDW3, A0A024R1I1 |
Cytogenetics | 22q12.2 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412745 | ZMAT5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423980 | ZMAT5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425098 | ZMAT5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY412745 | Transient overexpression lysate of zinc finger, matrin type 5 (ZMAT5), transcript variant 1 |
USD 396.00 |
|
LY423980 | Transient overexpression lysate of zinc finger, matrin type 5 (ZMAT5), transcript variant 2 |
USD 396.00 |
|
LY425098 | Transient overexpression lysate of zinc finger, matrin type 5 (ZMAT5), transcript variant 2 |
USD 396.00 |
|
TP302215 | Recombinant protein of human zinc finger, matrin type 5 (ZMAT5), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review