ZMAT5 (NM_019103) Human Mass Spec Standard

CAT#: PH302215

ZMAT5 MS Standard C13 and N15-labeled recombinant protein (NP_061976)

Product Images

Coomassie blue staining of purified ZMAT5 protein (Cat# TP302215). The protein was produced from HEK293T cells transfected with ZMAT5 cDNA clone (Cat# RC202215) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202215
• Predicted MW: 20 kDa
• Protein Sequence:
  Sequence Link

  >RC202215 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGS
  NCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYP
  VGWPPVQELPPSLRAPPPGGWPLQPRVQWG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061976
• RefSeq Size: 1051
• RefSeq ORF: 510
• Synonyms: SNRNP20; U11/U12-20K; ZC3H19
• Locus ID: 55954
• UniProt ID: Q9UDW3, A0A024R1I1
• Cytogenetics: 22q12.2