MYCBP (NM_012333) Human Mass Spec Standard

CAT#: PH302238

MYCBP MS Standard C13 and N15-labeled recombinant protein (NP_036465)

Product Images

Coomassie blue staining of purified MYCBP protein (Cat# TP302238). The protein was produced from HEK293T cells transfected with MYCBP cDNA clone (Cat# RC202238) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202238
• Predicted MW: 12 kDa
• Protein Sequence:
  Sequence Link

  >RC202238 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELA
  EMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036465
• RefSeq Size: 2583
• RefSeq ORF: 309
• Synonyms: AMY-1
• Locus ID: 26292
• UniProt ID: Q99417
• Cytogenetics: 1p34.3
• Summary: The protein encoded by this gene binds to the N-terminus of the oncogenic protein C-MYC, enhancing the ability of C-MYC to activate E box-dependent transcription. The encoded protein is normally found in the cytoplasm, but it translocates to the nucleus during S phase of the cell cycle and associates with C-MYC. This protein may be involved in spermatogenesis. This gene can be silenced by microRNA-22. Two transcript variants, one protein-coding and the other probably not protein-coding, have been found for this gene. [provided by RefSeq, Nov 2011]
• Protein Families: ES Cell Differentiation/IPS, Transcription Factors