ORMDL3 (NM_139280) Human Mass Spec Standard

CAT#: PH302279

ORMDL3 MS Standard C13 and N15-labeled recombinant protein (NP_644809)

Product Images

Coomassie blue staining of purified ORMDL3 protein (Cat# TP302279). The protein was produced from HEK293T cells transfected with ORMDL3 cDNA clone (Cat# RC202279) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202279
• Predicted MW: 17.5 kDa
• Protein Sequence:
  Sequence Link

  >RC202279 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGT
  PFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLP
  QLHGVRIFGINKY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_644809
• RefSeq Size: 2169
• RefSeq ORF: 459
• Synonyms: ORM1-like 3; ORM1-like 3 (S. cerevisiae); OTTHUMP00000164334
• Locus ID: 94103
• UniProt ID: Q8N138, A0A024R1W6
• Cytogenetics: 17q21.1
• Protein Families: Transmembrane