Gemin 6 (GEMIN6) (NM_024775) Human Mass Spec Standard

CAT#: PH302296

GEMIN6 MS Standard C13 and N15-labeled recombinant protein (NP_079051)

Product Images

Coomassie blue staining of purified GEMIN6 protein (Cat# TP302296). The protein was produced from HEK293T cells transfected with GEMIN6 cDNA clone (Cat# RC202296) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202296
• Predicted MW: 18.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202296 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVET
  MNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYD
  PENCSSSNEIILSRVQDLIEGHLTASQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079051
• RefSeq Size: 705
• RefSeq ORF: 501
• Synonyms: FLJ23459
• Locus ID: 79833
• UniProt ID: Q8WXD5
• Cytogenetics: 2p22.1
• Summary: GEMIN6 is part of a large macromolecular complex, localized to both the cytoplasm and the nucleus, that plays a role in the cytoplasmic assembly of small nuclear ribonucleoproteins (snRNPs). Other members of this complex include SMN (MIM 600354), GEMIN2 (SIP1; MIM 602595), GEMIN3 (DDX20; MIM 606168), GEMIN4 (MIM 606969), and GEMIN5 (MIM 607005). [supplied by OMIM, Jul 2002]
• Protein Families: Druggable Genome, Stem cell - Pluripotency