SYNJ2BP (NM_018373) Human Mass Spec Standard
CAT#: PH302394
SYNJ2BP MS Standard C13 and N15-labeled recombinant protein (NP_060843)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202394 |
Predicted MW | 15.9 kDa |
Protein Sequence |
>RC202394 protein sequence
Red=Cloning site Green=Tags(s) MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNG QDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEGDPSGIPIFMVLVPVFALTMVAAWAFMR YRQQL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_060843 |
RefSeq Size | 7074 |
RefSeq ORF | 435 |
Synonyms | ARIP2; OMP25 |
Locus ID | 55333 |
UniProt ID | P57105, A0A024R670 |
Cytogenetics | 14q24.2 |
Summary | Regulates endocytosis of activin type 2 receptor kinases through the Ral/RALBP1-dependent pathway and may be involved in suppression of activin-induced signal transduction. [UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402678 | SYNJ2BP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402678 | Transient overexpression lysate of synaptojanin 2 binding protein (SYNJ2BP) |
USD 396.00 |
|
TP302394 | Recombinant protein of human synaptojanin 2 binding protein (SYNJ2BP) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review