DHRS7B (NM_015510) Human Mass Spec Standard

CAT#: PH302625

DHRS7B MS Standard C13 and N15-labeled recombinant protein (NP_056325)

Product Images

Coomassie blue staining of purified DHRS7B protein (Cat# TP302625). The protein was produced from HEK293T cells transfected with DHRS7B cDNA clone (Cat# RC202625) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202625
• Predicted MW: 35.1 kDa
• Protein Sequence:
  Sequence Link

  >RC202625 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVSPATRKSLPKVKAMDFITSTAILPLLFGCLGVFGLFRLLQWVRGKAYLRNAVVVITGATSGLGKECAK
  VFYAAGAKLVLCGRNGGALEELIRELTASHATKVQTHKPYLVTFDLTDSGAIVAAAAEILQCFGYVDILV
  NNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRRQGHIVAISSIQGKMSIPFRSAYAAS
  KHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTAQGRSPVEVAQDVLAAV
  GKKKKDVILADLLPSLAVYLRTLAPGLFFSLMASRARKERKSKNS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056325
• RefSeq Size: 1841
• RefSeq ORF: 975
• Synonyms: CGI-93; SDR32C1
• Locus ID: 25979
• UniProt ID: Q6IAN0
• Cytogenetics: 17p11.2
• Summary: This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane