Dematin (DMTN) (NM_001978) Human Mass Spec Standard
CAT#: PH302895
EPB49 MS Standard C13 and N15-labeled recombinant protein (NP_001969)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202895 |
Predicted MW | 45.5 kDa |
Protein Sequence |
>RC202895 protein sequence
Red=Cloning site Green=Tags(s) MERLQKQPLTSPGSVSPSRDSSVPGSPSSIVAKMDNQVLGYKDLAAIPKDKAILDIERPDLMIYEPHFTY SLLEHVELPRSRERSLSPKSTSPPPSPEVWADSRSPGIISQASAPRTTGTPRTSLPHFHHPETSRPDSNI YKKPPIYKQRESVGGSPQTKHLIEDLIIESSKFPAAQPPDPNQPAKIETDYWPCPPSLAVVETEWRKRKA SRRGAEEEEEEEDDDSGEEMKALRERQREELSKVTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTSL HQGTSKSSSLPAYGRTTLSRLQSTEFSPSGSETGSPGLQNGEGQRGRMDRGNSLPCVLEQKIYPYEMLVV TNKGRTKLPPGVDRMRLERHLSAEDFSRVFAMSPEEFGKLALWKRNELKKKASLF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001969 |
RefSeq Size | 2825 |
RefSeq ORF | 1215 |
Synonyms | DMT; EPB49 |
Locus ID | 2039 |
UniProt ID | Q08495 |
Cytogenetics | 8p21.3 |
Summary | 'The protein encoded by this gene is an actin binding and bundling protein that plays a structural role in erythrocytes, by stabilizing and attaching the spectrin/actin cytoskeleton to the erythrocyte membrane in a phosphorylation-dependent manner. This protein contains a core domain in the N-terminus, and a headpiece domain in the C-terminus that binds F-actin. When purified from erythrocytes, this protein exists as a trimer composed of two 48 kDa polypeptides and a 52 kDa polypeptide. The different subunits arise from alternative splicing in the 3' coding region, where the headpiece domain is located. Disruption of this gene has been correlated with the autosomal dominant Marie Unna hereditary hypotrichosis disease, while loss of heterozygosity of this gene is thought to play a role in prostate cancer progression. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Nov 2014]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419611 | DMTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426463 | DMTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426464 | DMTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426467 | DMTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419611 | Transient overexpression lysate of erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 1 |
USD 396.00 |
|
LY426463 | Transient overexpression lysate of erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 2 |
USD 396.00 |
|
LY426464 | Transient overexpression lysate of erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 3 |
USD 396.00 |
|
LY426467 | Transient overexpression lysate of erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 6 |
USD 396.00 |
|
PH325631 | EPB49 MS Standard C13 and N15-labeled recombinant protein (NP_001107608) |
USD 2,055.00 |
|
PH325632 | EPB49 MS Standard C13 and N15-labeled recombinant protein (NP_001107607) |
USD 2,055.00 |
|
TP302895 | Recombinant protein of human erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 1 |
USD 823.00 |
|
TP325631 | Recombinant protein of human erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 3 |
USD 748.00 |
|
TP325632 | Recombinant protein of human erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 2 |
USD 748.00 |
|
TP710364 | Purified recombinant protein of Human erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 1, full length, with with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review