HES6 (NM_018645) Human Mass Spec Standard

CAT#: PH303205

HES6 MS Standard C13 and N15-labeled recombinant protein (NP_061115)

Product Images

Coomassie blue staining of purified HES6 protein (Cat# TP303205). The protein was produced from HEK293T cells transfected with HES6 cDNA clone (Cat# RC203205) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203205
• Predicted MW: 24.1 kDa
• Protein Sequence:
  Sequence Link

  >RC203205 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQAKLENAEVLELT
  VRRVQGVLRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATVAAELLNHLLESMPLREGSS
  FQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSPPGPGDDLCSDLEEAPEAELSQAPAEGPDLVPAALGS
  LTTAQIARSVWRPW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061115
• RefSeq Size: 1470
• RefSeq ORF: 672
• Synonyms: bHLHb41; bHLHc23; C-HAIRY1; HES-6
• Locus ID: 55502
• UniProt ID: Q96HZ4
• Cytogenetics: 2q37.3
• Summary: This gene encodes a member of a subfamily of basic helix-loop-helix transcription repressors that have homology to the Drosophila enhancer of split genes. Members of this gene family regulate cell differentiation in numerous cell types. The protein encoded by this gene functions as a cofactor, interacting with other transcription factors through a tetrapeptide domain in its C-terminus. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Dec 2008]
• Protein Families: Druggable Genome, Transcription Factors