Melanoma Inhibitory Activity (MIA) (NM_006533) Human Mass Spec Standard

CAT#: PH303245

MIA MS Standard C13 and N15-labeled recombinant protein (NP_006524)

Product Images

Coomassie blue staining of purified MIA protein (Cat# TP303245). The protein was produced from HEK293T cells transfected with MIA cDNA clone (Cat# RC203245) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203245
• Predicted MW: 14.5 kDa
• Protein Sequence:
  Sequence Link

  >RC203245 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVV
  YVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006524
• RefSeq Size: 654
• RefSeq ORF: 393
• Synonyms: CD-RAP
• Locus ID: 8190
• UniProt ID: Q16674, A0A024R0P1
• Cytogenetics: 19q13.2
• Summary: Elicits growth inhibition on melanoma cells in vitro as well as some other neuroectodermal tumors, including gliomas. [UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein, Transmembrane