DAP13 (NDUFA12) (NM_018838) Human Mass Spec Standard
CAT#: PH303265
NDUFA12 MS Standard C13 and N15-labeled recombinant protein (NP_061326)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203265 |
Predicted MW | 17.1 kDa |
Protein Sequence |
>RC203265 protein sequence
Red=Cloning site Green=Tags(s) MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNG KNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLAARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPP STPYK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_061326 |
RefSeq Size | 592 |
RefSeq ORF | 435 |
Synonyms | B17.2; DAP13; MC1DN23 |
Locus ID | 55967 |
UniProt ID | Q9UI09 |
Cytogenetics | 12q22 |
Summary | This gene encodes a protein which is part of mitochondrial complex 1, part of the oxidative phosphorylation system in mitochondria. Complex 1 transfers electrons to ubiquinone from NADH which establishes a proton gradient for the generation of ATP. Mutations in this gene are associated with Leigh syndrome due to mitochondrial complex 1 deficiency. Pseudogenes of this gene are located on chromosomes 5 and 13. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2012] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412878 | NDUFA12 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY412878 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 (NDUFA12) |
USD 396.00 |
|
TP303265 | Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 (NDUFA12) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review