G gamma12 (GNG12) (NM_018841) Human Mass Spec Standard

CAT#: PH303268

GNG12 MS Standard C13 and N15-labeled recombinant protein (NP_061329)

Product Images

Coomassie blue staining of purified GNG12 protein (Cat# TP303268). The protein was produced from HEK293T cells transfected with GNG12 cDNA clone (Cat# RC203268) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203268
• Predicted MW: 7.9 kDa
• Protein Sequence:
  Sequence Link

  >RC203268 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSKTASTNNIAQARRTVQQLRLEASIEGIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCI
  IL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061329
• RefSeq Size: 4427
• RefSeq ORF: 216
• Synonyms: FLJ31352; FLJ34695
• Locus ID: 55970
• UniProt ID: Q9UBI6
• Cytogenetics: 1p31.3
• Summary: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. [UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway, MAPK signaling pathway, Regulation of actin cytoskeleton