RTDR1 (RSPH14) (NM_014433) Human Mass Spec Standard

CAT#: PH303725

RTDR1 MS Standard C13 and N15-labeled recombinant protein (NP_055248)

Product Images

Coomassie blue staining of purified RSPH14 protein (Cat# TP303725). The protein was produced from HEK293T cells transfected with RSPH14 cDNA clone (Cat# RC203725) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203725
• Predicted MW: 38.6 kDa
• Protein Sequence:
  Sequence Link

  >RC203725 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMALCDLMHDPECIYKAMNIGCME
  NLKALLKDSNSMVRIKTTEVLHITASHSVGRYAFLEHDIVLALSFLLNDPSPVCRGNLYKAYMQLVQVPR
  GAQEIISKGLISSLVWKLQVEVEEEEFQEFILDTLVLCLQEDATEALGSNVVLVLKQKLLSANQNIRSKA
  ARALLNVSISREGKKQVCHFDVIPILVHLLKDPVEHVKSNAAGALMFATVITEGKYAALEAQAIGLLLEL
  LHSPMTIARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRAARIAISVIEFKP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055248
• RefSeq Size: 1286
• RefSeq ORF: 1044
• Synonyms: RTDR1
• Locus ID: 27156
• UniProt ID: Q9UHP6
• Cytogenetics: 22q11.22-q11.23
• Summary: This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome