RTDR1 (RSPH14) (NM_014433) Human Mass Spec Standard
CAT#: PH303725
RTDR1 MS Standard C13 and N15-labeled recombinant protein (NP_055248)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203725 |
Predicted MW | 38.6 kDa |
Protein Sequence |
>RC203725 protein sequence
Red=Cloning site Green=Tags(s) MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMALCDLMHDPECIYKAMNIGCME NLKALLKDSNSMVRIKTTEVLHITASHSVGRYAFLEHDIVLALSFLLNDPSPVCRGNLYKAYMQLVQVPR GAQEIISKGLISSLVWKLQVEVEEEEFQEFILDTLVLCLQEDATEALGSNVVLVLKQKLLSANQNIRSKA ARALLNVSISREGKKQVCHFDVIPILVHLLKDPVEHVKSNAAGALMFATVITEGKYAALEAQAIGLLLEL LHSPMTIARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRAARIAISVIEFKP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055248 |
RefSeq Size | 1286 |
RefSeq ORF | 1044 |
Synonyms | RTDR1 |
Locus ID | 27156 |
UniProt ID | Q9UHP6 |
Cytogenetics | 22q11.22-q11.23 |
Summary | This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415282 | RSPH14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415282 | Transient overexpression lysate of rhabdoid tumor deletion region gene 1 (RTDR1) |
USD 396.00 |
|
TP303725 | Recombinant protein of human rhabdoid tumor deletion region gene 1 (RTDR1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review