STEAP1 (NM_012449) Human Mass Spec Standard
CAT#: PH303970
STEAP1 MS Standard C13 and N15-labeled recombinant protein (NP_036581)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203970 |
Predicted MW | 39.9 kDa |
Protein Sequence |
>RC203970 protein sequence
Red=Cloning site Green=Tags(s) MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQ WHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQ LHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIE HDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDI KQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_036581 |
RefSeq Size | 1330 |
RefSeq ORF | 1017 |
Synonyms | PRSS24; STEAP |
Locus ID | 26872 |
UniProt ID | Q9UHE8 |
Cytogenetics | 7q21.13 |
Summary | This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell-cell junctions. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402215 | STEAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402215 | Transient overexpression lysate of six transmembrane epithelial antigen of the prostate 1 (STEAP1) |
USD 396.00 |
|
TP303970 | Recombinant protein of human six transmembrane epithelial antigen of the prostate 1 (STEAP1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review