GIMAP5 (NM_018384) Human Mass Spec Standard

CAT#: PH303978

GIMAP5 MS Standard C13 and N15-labeled recombinant protein (NP_060854)

Product Images

Coomassie blue staining of purified GIMAP5 protein (Cat# TP303978). The protein was produced from HEK293T cells transfected with GIMAP5 cDNA clone (Cat# RC203978) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203978
• Predicted MW: 34.8 kDa
• Protein Sequence:
  Sequence Link

  >RC203978 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGGFQRGKYGTMAEGRSEDNLSATPPALRIILVGKTGCGKSATGNSILGQPVFESKLRAQSVTRTCQVKT
  GTWNGRKVLVVDTPSIFESQADTQELYKNIGDCYLLSAPGPHVLLLVIQLGRFTAQDTVAIRKVKEVFGT
  GAMRHVVILFTHKEDLGGQALDDYVANTDNCSLKDLVRECERRYCAFNNWGSVEEQRQQQAELLAVIERL
  GREREGSFHSNDLFLDAQLLQRTGAGACQEDYRQYQAKVEWQVEKHKQELRENESNWAYKALLRVKHLML
  LHYEIFVFLLLCSILFFIIFLFIFHYI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060854
• RefSeq Size: 1895
• RefSeq ORF: 921
• Synonyms: HIMAP3; IAN-5; IAN4; IAN4L1; IAN5; IMAP3; IROD
• Locus ID: 55340
• UniProt ID: Q96F15, A0A090N8P9
• Cytogenetics: 7q36.1
• Summary: This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. This gene encodes an antiapoptotic protein that functions in T-cell survival. Polymorphisms in this gene are associated with systemic lupus erythematosus. Read-through transcription exists between this gene and the neighboring upstream GIMAP1 (GTPase, IMAP family member 1) gene. [provided by RefSeq, Dec 2010]
• Protein Families: Transmembrane