NOSIP (NM_015953) Human Mass Spec Standard

CAT#: PH304024

NOSIP MS Standard C13 and N15-labeled recombinant protein (NP_057037)

Product Images

Coomassie blue staining of purified NOSIP protein (Cat# TP304024). The protein was produced from HEK293T cells transfected with NOSIP cDNA clone (Cat# RC204024) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204024
• Predicted MW: 33.2 kDa
• Protein Sequence:
  Sequence Link

  >RC204024 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAI
  LEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPD
  DVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVD
  RVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGG
  TGFAGSGVKLQAEKSRPVMQA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057037
• RefSeq Size: 1367
• RefSeq ORF: 903
• Synonyms: CGI-25
• Locus ID: 51070
• UniProt ID: Q9Y314
• Cytogenetics: 19q13.33
• Summary: The protein encoded by this gene may modulate the activity and localization of nitric oxide synthase (endothelial and neuronal) and thus nitric oxide production. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Aug 2012]