IGFBP4 (NM_001552) Human Mass Spec Standard

CAT#: PH304188

IGFBP4 MS Standard C13 and N15-labeled recombinant protein (NP_001543)

Product Images

Coomassie blue staining of purified IGFBP4 protein (Cat# TP304188). The protein was produced from HEK293T cells transfected with IGFBP4 cDNA clone (Cat# RC204188) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204188
• Predicted MW: 27.9 kDa
• Protein Sequence:
  Sequence Link

  >RC204188 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLPLCLVAALLLAAGPGPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVY
  TPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQ
  KHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNF
  HPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001543
• RefSeq Size: 2246
• RefSeq ORF: 774
• Synonyms: BP-4; HT29-IGFBP; IBP4; IGFBP-4
• Locus ID: 3487
• UniProt ID: P22692, A0A024R1U8
• Cytogenetics: 17q21.2
• Summary: 'This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. [provided by RefSeq, Jul 2008]'
• Protein Families: Secreted Protein