CD43 (SPN) (NM_003123) Human Mass Spec Standard
CAT#: PH304195
SPN MS Standard C13 and N15-labeled recombinant protein (NP_003114)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204195 |
Predicted MW | 40.3 kDa |
Protein Sequence |
>RC204195 protein sequence
Red=Cloning site Green=Tags(s) MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTS INEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSP ETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTG SLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRR QKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRK SRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003114 |
RefSeq Size | 6911 |
RefSeq ORF | 1200 |
Synonyms | CD43; GALGP; GPL115; LSN |
Locus ID | 6693 |
UniProt ID | P16150, A0A024R629 |
Cytogenetics | 16p11.2 |
Summary | 'This gene encodes a highly sialylated glycoprotein that functions in antigen-specific activation of T cells, and is found on the surface of thymocytes, T lymphocytes, monocytes, granulocytes, and some B lymphocytes. It contains a mucin-like extracellular domain, a transmembrane region and a carboxy-terminal intracellular region. The extracellular domain has a high proportion of serine and threonine residues, allowing extensive O-glycosylation, and has one potential N-glycosylation site, while the carboxy-terminal region has potential phosphorylation sites that may mediate transduction of activation signals. Different glycoforms of this protein have been described. In stimulated immune cells, proteolytic cleavage of the extracellular domain occurs in some cell types, releasing a soluble extracellular fragment. Defects in expression of this gene are associated with Wiskott-Aldrich syndrome. [provided by RefSeq, Sep 2017]' |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs) |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418888 | SPN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422249 | SPN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425516 | SPN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418888 | Transient overexpression lysate of sialophorin (SPN), transcript variant 2 |
USD 396.00 |
|
LY422249 | Transient overexpression lysate of sialophorin (SPN), transcript variant 1 |
USD 396.00 |
|
LY425516 | Transient overexpression lysate of sialophorin (SPN), transcript variant 1 |
USD 396.00 |
|
TP304195 | Recombinant protein of human sialophorin (SPN), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review