HNRPAB (HNRNPAB) (NM_031266) Human Mass Spec Standard
CAT#: PH304360
HNRNPAB MS Standard C13 and N15-labeled recombinant protein (NP_112556)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204360 |
Predicted MW | 35.8 kDa |
Protein Sequence |
>RC204360 representing NM_031266
Red=Cloning site Green=Tags(s) MSEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAG KMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVI DPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKK VLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQGYGNYWNQGY GYQQGYGPGYGGYDYSPYGYYGYGPGYDYSQGSTNYGKSQRRGGHQNNYKPY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_112556 |
RefSeq Size | 1837 |
RefSeq ORF | 996 |
Synonyms | ABBP1; HNRPAB |
Locus ID | 3182 |
UniProt ID | Q99729 |
Cytogenetics | 5q35.3 |
Summary | 'This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes. They are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene, which binds to one of the components of the multiprotein editosome complex, has two repeats of quasi-RRM (RNA recognition motif) domains that bind to RNAs. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410605 | HNRNPAB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC417947 | HNRNPAB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410605 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A/B (HNRNPAB), transcript variant 1 |
USD 396.00 |
|
LY417947 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A/B (HNRNPAB), transcript variant 2 |
USD 396.00 |
|
TP304360 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein A/B (HNRNPAB), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review