SMR3B (NM_006685) Human Mass Spec Standard

CAT#: PH304422

SMR3B MS Standard C13 and N15-labeled recombinant protein (NP_006676)

Product Images

Coomassie blue staining of purified SMR3B protein (Cat# TP304422). The protein was produced from HEK293T cells transfected with SMR3B cDNA clone (Cat# RC204422) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204422
• Predicted MW: 8.2 kDa
• Protein Sequence:
  Sequence Link

  >RC204422 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPG
  IFPPPPPQP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006676
• RefSeq Size: 798
• RefSeq ORF: 237
• Synonyms: P-B; PBII; PRL3; PROL3; SMR1B
• Locus ID: 10879
• UniProt ID: P02814, Q504X8
• Cytogenetics: 4q13.3
• Protein Families: Secreted Protein