Ubiquitin D (UBD) (NM_006398) Human Mass Spec Standard

CAT#: PH304431

UBD MS Standard C13 and N15-labeled recombinant protein (NP_006389)

Product Images

Coomassie blue staining of purified UBD protein (Cat# TP304431). The protein was produced from HEK293T cells transfected with UBD cDNA clone (Cat# RC204431) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204431
• Predicted MW: 18.5 kDa
• Protein Sequence:
  Sequence Link

  >RC204431 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDK
  EKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLE
  DGKMMADYGIRKGNLLFLACYCIGG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006389
• RefSeq Size: 1006
• RefSeq ORF: 495
• Synonyms: FAT10; GABBR1; UBD-3
• Locus ID: 10537
• UniProt ID: O15205, A0A1U9X8S6
• Cytogenetics: 6p22.1
• Summary: This gene encodes a protein which contains two ubiquitin-like domains and appears to have similar function to ubiquitin. Through covalent attachment, the encoded protein targets other proteins for 26S proteasome degradation. This protein has been implicated to function in many cellular processes, including caspase-dependent apoptosis, formation of aggresomes, mitotic regulation, and dendritic cell maturation. Upregulation of this gene may promote inflammation in chronic kidney disease and has been observed in many cancer types. [provided by RefSeq, Aug 2017]
• Protein Families: Druggable Genome