CFHL2 (CFHR2) (NM_005666) Human Mass Spec Standard

CAT#: PH304689

CFHR2 MS Standard C13 and N15-labeled recombinant protein (NP_005657)

Product Images

Coomassie blue staining of purified CFHR2 protein (Cat# TP304689). The protein was produced from HEK293T cells transfected with CFHR2 cDNA clone (Cat# RC204689) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204689
• Predicted MW: 30.7 kDa
• Protein Sequence:
  Sequence Link

  >RC204689 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWLLVSVILISRISSVGGEAMFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRI
  TCAEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYRLQNNENNISCVERGWSTPPKC
  RSTISAEKCGPPPPIDNGDITSFLLSVYAPGSSVEYQCQNLYQLEGNNQITCRNGQWSEPPKCLDPCVIS
  QEIMEKYNIKLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEEK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005657
• RefSeq Size: 1043
• RefSeq ORF: 810
• Synonyms: CFHL2; FHR2; HFL3
• Locus ID: 3080
• UniProt ID: P36980
• Cytogenetics: 1q31.3
• Summary: 'This gene belongs to a family of complement factor H-related genes (CFHR), which are clustered together with complement factor H gene on chromosome 1, and are involved in regulation of complement. Mutations in CFHR genes have been associated with dense deposit disease and atypical haemolytic-uraemic syndrome. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2015]'
• Protein Families: Secreted Protein