LIM domain only 3 (LMO3) (NM_018640) Human Mass Spec Standard
CAT#: PH305190
LMO3 MS Standard C13 and N15-labeled recombinant protein (NP_061110)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205190 |
Predicted MW | 16.6 kDa |
Protein Sequence |
>RC205190 protein sequence
Red=Cloning site Green=Tags(s) MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRL FGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGY APQVR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_061110 |
RefSeq Size | 3850 |
RefSeq ORF | 435 |
Synonyms | RBTN3; RBTNL2; Rhom-3; RHOM3 |
Locus ID | 55885 |
UniProt ID | Q8TAP4, A0A024RAT1 |
Cytogenetics | 12p12.3 |
Summary | The protein encoded by this gene belongs to the rhombotin family of cysteine-rich LIM domain oncogenes. This gene is predominantly expressed in the brain. Related family members, LMO1 and LMO2 on chromosome 11, have been reported to be involved in chromosomal translocations in T-cell leukemia. Many alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2011] |
Protein Families | Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402699 | LMO3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC424337 | LMO3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402699 | Transient overexpression lysate of LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1 |
USD 396.00 |
|
LY424337 | Transient overexpression lysate of LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 2 |
USD 396.00 |
|
TP305190 | Recombinant protein of human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1 |
USD 823.00 |
|
TP760247 | Recombinant protein of human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
|
TP761633 | Purified recombinant protein of Human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review