LIM domain only 3 (LMO3) (NM_018640) Human Mass Spec Standard

CAT#: PH305190

LMO3 MS Standard C13 and N15-labeled recombinant protein (NP_061110)

Product Images

Coomassie blue staining of purified LMO3 protein (Cat# TP305190). The protein was produced from HEK293T cells transfected with LMO3 cDNA clone (Cat# RC205190) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205190
• Predicted MW: 16.6 kDa
• Protein Sequence:
  Sequence Link

  >RC205190 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRL
  FGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGY
  APQVR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061110
• RefSeq Size: 3850
• RefSeq ORF: 435
• Synonyms: RBTN3; RBTNL2; Rhom-3; RHOM3
• Locus ID: 55885
• UniProt ID: Q8TAP4, A0A024RAT1
• Cytogenetics: 12p12.3
• Summary: The protein encoded by this gene belongs to the rhombotin family of cysteine-rich LIM domain oncogenes. This gene is predominantly expressed in the brain. Related family members, LMO1 and LMO2 on chromosome 11, have been reported to be involved in chromosomal translocations in T-cell leukemia. Many alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2011]
• Protein Families: Transcription Factors